Welcome to Alfa Vids. Free Porn Tube, Young Sex Videos, Young Porn Movies
Title: Welcome to Alfa Vids. Free Porn Tube, Young Sex Videos, Young Porn Movies
Keywords: Free Porn Tube, Young Porn Movies, Young Sex Videos, Teen Sex Clips, XXX Teen Porn, Teen Clips, Young Teen Sex Clips, Free Sex Tube
Description: Free Young Porn Movies and Young Sex Videos from is ranked 12965221 in the world (amongst the 40 million domains). A low-numbered rank means that this website gets lots of visitors. This site is relatively popular among users in the united states. It gets 50% of its traffic from the united states .This site is estimated to be worth $9,180. This site has a low Pagerank(0/10). It has 1 backlinks. has 43% seo score. Information

Website / Domain:
Website IP Address:
Domain DNS Server:, Rank

Alexa Rank: 12965221
Google Page Rank: 0/10 (Google Pagerank Has Been Closed) Traffic & Earnings

Purchase/Sale Value: $9,180
Daily Revenue: $25
Monthly Revenue $754
Yearly Revenue: $9,180
Daily Unique Visitors 2,314
Monthly Unique Visitors: 69,420
Yearly Unique Visitors: 844,610 WebSite Httpheader

StatusCode 200
Content-Type text/html; charset=utf-8
Date Tue, 09 Aug 2016 02:40:33 GMT
Server nginx/1.10.1 Keywords accounting

Keyword Count Percentage
Free Porn Tube 1 0.10%
Young Porn Movies 1 0.12%
Young Sex Videos 1 0.12%
Teen Sex Clips 0 0.00%
XXX Teen Porn 0 0.00%
Teen Clips 0 0.00%
Young Teen Sex Clips 0 0.00%
Free Sex Tube 1 0.10% Traffic Sources Chart Similar Website

Domain Site Title Young Porn Tube, Teenage Sex Videos, Kinky Girls Fuck Movies Tiny 18 Tube - Young Porn Movies, Teen Pussy, Sex Videos Young Porn Tube - Sex Videos, Xxx Movies, Teen Pussy Fuck Free Young Porn Tube, XXX Porn Tube, Young Sex Tube Porn Tube, Porn Tube Sex, Young XXX Porn, Free Porn Tube Movies Young teen tube - teen porn tube videos, free teen sex tube movies Teens Porn - Free XXX Tube, Teen Sex Videos, Young Porn Movies PORNO TUBE VIDEOS, SEX MOVIES, FREE PORN TUBES CLIPS, YOUNG PUSSY PORN Free Teen Porn, Young Sex, Teen XXX Tube Movies at HQ Teen Porn Videos HD Porn Videos. Free XXX Tube. Hot Sex Movies, Vids Alexa Rank History Chart aleax Html To Plain Text

Welcome to Alfa Vids. Free Porn Tube, Young Sex Videos, Young Porn Movies Filthy Teen Movies Free Hairy Xxx New Porn Video Hot Blowjob Porn My Home Sex HQ Free Porn Love Video World Fresh Porn Movies Kind Teen Sex Messy xxx tube Matured Tube Old Sex Tube Sort by: Date -any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago Dur -any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutesmore than 90 minutes Tube -any tube-4tube5ilthyAh-MeAlphaPornoaShemaleTubeBeegbigXvideosDachixDeviantClipDrTuberEmpFlixfilthyrxFuxGaysPowergfssexgivemeGayHardsextubeHDpornKeezMoviesMovieFapMoviesAndNuvidOverThumbspornPornerBrosPornHubPornoxoPornRabbitPornTubeRawTubeRedTubeSunPornoTnaFlixTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn Age -all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung Country -all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish 781513 Teen Hardcore Video 629411 Teen Teen Video 573230 Teen Tits Video 546690 Teen Amateur Video 498257 Teen Sex Video 482375 Teen Babe Video 363131 Teen Anal Video 300773 Teen Ass Video 293140 Teen Mature Video 226560 Teen Asian Video 223309 Teen Lesbian Video 217830 Teen Cum Video 171956 Teen Titty Fuck Video 129501 Teen Webcam Video 117231 Teen Tranny Video 110465 Teen Hairy Video 109626 Teen Japanese Video 98246 Teen Shemale Video 96944 Teen Handjob Video 88779 Teen Voyeur Video 78489 Teen Cute Video 72290 Teen Creampie Video 70825 Teen Party Video 58105 Teen Reality Video 57854 Teen Massage Video 53568 Teen Lesbian Teen Video 50881 Teen Orgy Video 49732 Teen Orgasm Video 48162 Teen Adorable Video 47695 Teen Student Video 42662 Teen Huge Cock Video 40597 Teen Twink Video 38240 Teen Gangbang Video 37735 Teen Deepthroat Video 36215 Teen Vintage Video 36211 Teen Huge Tits Video 33712 Teen Group Orgy Video 31122 Teen Cum In Mouth Video 28249 Teen Oriental Video 27083 Teen Cum Swallowing Video 26051 Teen Bondage Video 24142 Teen Hidden Cam Video 23724 Teen 18 Year Old Video 22627 Teen Big Natural Tits Video 22303 Teen Bizarre Video 22161 Teen German Video 18925 Teen Squirt Video 16126 Teen Old Young Video 15986 Teen Compilation Video 15081 Teen Brazilian Video 14377 Teen French Video 14280 Teen Monster Cock Video 14061 Teen 69 Video 13629 Teen Bisexual Video 12881 Teen Dancing Video 12072 Teen Indian Video 11142 Teen Double Fucking Video 11109 Teen Nurse Video 10816 Teen Old Man Video 10785 Teen Casting Video 9807 Teen Chinese Video 9373 Teen Swinger Video 8277 Teen Italian Video 8126 Teen Doctor Video 6674 Teen Arabian Video 6420 Teen Korean Video 6154 Teen Thai Video 4676 Teen Forced Video 4410 Teen Leather Video 3750 Teen Bus Video 2396 Teen Erotic Art Video 2378 Teen Short Hair Video 2148 Teen Sleeping Video 2138 Teen Surprise Video 1967 Teen Mature Teacher Video 1927 Teen 10+ Inch Cock Video 1810 Teen Behind The Scenes Video 1746 Teen Cucumber Video 1038 Teen Twins Video 795 Teen Army Video 772 Teen Ugly Video 641 Teen Lactating Video 413 Teen Cinema Video 368 Teen Indonesian Video 337 Teen Pakistani Video 279 Teen Alien Video 175 Teen Watersport Video 237710 Teen Cumshot Video 211906 Teen Gay Video 190447 Teen Boobs Video 180054 Teen Public Video 160803 Teen Milf Video 152373 Teen 3some Video 140322 Teen Bbw Video 129088 Teen Facial Video 126135 Teen Solo Video 112564 Teen Beauty Video 74339 Teen Nude Video 47638 Teen Big Black Cock Video 41309 Teen Panties Video 40436 Teen Fat Video 29382 Teen Giving Head Video 17060 Teen Nudist Video 16806 Teen Office Video 16744 Teen Cuckold Video 13820 Teen Dped Video 13608 Teen Tgirl Video 13218 Teen Teacher Video 12335 Teen Slave Video 12262 Teen 19 Year Old Video 11274 Teen Beach Video 11042 Teen African Video 11033 Teen Classic Video 10516 Teen Sologirl Video 9875 Teen Kitchen Video 5793 Teen Prostitute Video 5494 Teen Crossdressing Video 5258 Teen Adultery Video 5225 Teen Cum Swapping Video 5134 Teen Husband Video 3307 Teen Wrestling Video 2815 Teen Turkish Video 2795 Teen Mexican Video 2708 Teen Forest Video 1745 Teen Lockerroom Video 1639 Teen Old Young Lesbian Video 1454 Teen Acrobatic Video 470 Teen Stewardess Video 1079209 Teen Blowjob Video 705512 Teen Fucking Video 649118 Teen Fetish Video 403098 Teen Pussy Video 374011 Teen Girl Video 365280 Teen Big Tits Video 318678 Teen Masturbating Video 287179 Teen Big Cock Video 285606 Teen Group Sex Video 245121 Teen Dick Video 207348 Teen Ebony Video 174670 Teen Black Video 162384 Teen Couple Video 153397 Teen Interracial Video 132268 Teen Bdsm Video 124442 Teen Doggystyle Video 122963 Teen Big Ass Video 116797 Teen Pov Video 114778 Teen Home Made Video 113126 Teen Dildo Video 102588 Teen Latina Video 96658 Teen Outdoor Video 83160 Teen Stockings Video 67674 Teen College Girl Video 64874 Teen Mature Amateur Video 64294 Teen Hd Video 61034 Teen Russian Video 51717 Teen Strap On Video 44447 Teen Tease Video 43412 Teen Jerking Video 38973 Teen Wife Video 37267 Teen Mature Lesbian Video 36874 Teen Pretty Video 36659 Teen Asshole Video 35820 Teen Femdom Video 35276 Teen Sperm Video 34326 Teen Anal Toying Video 33000 Teen Funny Video 27366 Teen Cfnm Video 24742 Teen Flasher Video 23544 Teen Anal Creampie Video 22073 Teen Fisting Video 21186 Teen Chubby Video 19827 Teen Tiny Video 19795 Teen Bukkake Video 19507 Teen Throat Fucked Video 19482 Teen Transsexual Video 18401 Teen Perverted Video 17218 Teen Cowgirl Video 16952 Teen Juggs Video 16799 Teen Seduce Video 16659 Teen Nipples Video 15042 Teen Muscled Video 14358 Teen Upskirt Video 14141 Teen Missionary Video 13859 Teen Car Video 12890 Teen Spanked Video 11339 Teen Housewife Video 10875 Teen Ffm Video 10723 Teen Czech Video 9159 Teen Footjob Video 8760 Teen Spy Video 8385 Teen Tiny Tits Video 8080 Teen Cougar Video 7663 Teen Hotel Video 7431 Teen Cash Video 6806 Teen 3d Video 6431 Teen Milk Video 6238 Teen Afro Video 5790 Teen Maid Video 5640 Teen Fat Mature Video 5588 Teen Shy Video 4950 Teen Retro Video 4871 Teen Babysitter Video 4870 Teen Face Sitting Video 3962 Teen Audition Video 3958 Teen Cheating Video 3536 Teen Satin Video 3349 Teen Story Video 2944 Teen Old Farts Video 2448 Teen Screaming Video 2401 Teen Trimmed Pussy Video 2387 Teen Police Video 2278 Teen On Her Knees Video 2160 Teen Exhibitionists Video 2020 Teen Hungarian Video 1443 Teen Filipina Video 1277 Teen Midget Video 1218 Teen Dungeon Video 1199 Teen Lesbian Gangbang Video 1071 Teen Sauna Video 831 Teen Nun Video 677 Teen Saggy Tits Video 644 Teen Real Doll Video 609 Teen Wedding Video 503 Teen Intro Video 502 Teen Egyptian Video 450 Teen Ballerina Video 206 Teen Hypnotized Video 160 Teen Hermaphrodite Video 60 Teen Titless Video 126151 Teen Busty Video Categories # 10+ Inch Cock 18 Year Old 19 Year Old 3d 3some 4some 69 A Acrobatic Adorable Adultery Aerobics African Afro Aged Alien Amateur American Amputee Anal Anal Beads Anal Creampie Anal Dilation Anal Fisting Anal Toying Animation Anime Antique Anus Arabian Argentinian Army Artistic Asian Asian Teen Ass Ass-To-Mouth Assfucking Asshole Asslick Audition B Babe Babysitter Backseat Backstage Ball Busting Ball Kicking Ball Licking Ballerina Balloon Banana Banging Barely Legal Bargirl Baseball(bat) Basement Basketball Bathing Bathroom Bbw Bdsm Beach Beads Bear Beauty Beaver Bedroom Beer Behind The Scenes Belly Bend Over Beurette Bicycle Big Ass Big Black Cock Big Clit Big Cock Big Natural Tits Big Nipples Big Tits Biker Bikini Bimbo Bisexual Bitch Bizarre Black Blindfolded Blonde Bloopers Blowjob Boat Bodystocking Bombshell Bondage Boobs Boots Booty Boss Bottle Bound Bra Braces Braids Brazilian Bride British Brunette Bukkake Bunny Bus Bush Busty Butt Buttfucking Butthole Buttplug Buxom C Cage Cameltoe Caneing Caning Car Cartoon Cash Casting Catfight Catsuit Centerfold Cfnm Chained Champagne Cheating Cheerleader Chinese Choking Chubby Chunky Cigarette Cinema Classic Classroom Classy Cleaner Cleavage Clit Close up Clothed Sex Clown Club Coed Coffin Collar College Girl Comic Competition Compilation Condom Play Corset Cotton Panties Cougar Country Couple Cowgirl Crack Whore Crazy Creampie Crop Whip Crossdressing Crotchless Panties Crying Cuban Cuckold Cucumber Cum Cum Brushing Cum Covered Cum Drenched Cum Gargling Cum In Her Eyes Cum In Mouth Cum Swallowing Cum Swapping Cumshot Cunt Curly Haired Cute Czech D Dancing Dark Hair Dating Deepthroat Desk Diaper Dick Dildo Doctor Doggystyle Doll Domination Dominatrix Dorm Double Blowjob Double Fisting Double Fucking Double Toying Dped DPed Anal DPed Pussy Drilled Drooling Dungeon Dutch Dyed Hair Dyke E Ebony Egyptian Electrified Emo Enema Erotic Art Escort Ethnic European Ex-girlfriend Exhibitionists Exotic Experienced Exploited F Face Fucked Face Sitting Facial Fake Tits Farm Farting Fat Fat Mature Fat Teen Feet Felching Female Ejaculation Femdom Feminization Fetish Ffm Filipina Fingering Finnish First Time Fishnet Fisting Fitness Flasher Flat Chested Fleshlight Flexible Flogger Whip Florida Fondling Food Footjob Forced Foreplay Forest Four Fingering Freckled French Fucking Funny Fur G Gagged Gagging Game Gangbang Gaping Hole Garden Garter Belts Gay German Ghetto Girl Girl Fucks Guy Girl Nextdoor Giving Head Glamour Glasses Gloryhole Gloves Golden Shower Golf Gorgeous Goth Greek Group Orgy Group Sex Gym Gyno Exam H Hair Pulling Hairless Hairy Halloween Handcuffed Handjob Hardcore Hardrock Hawaiian Hd Hentai Hermaphrodite Hidden Cam High Heels Hippy Hirsute Hitch Hiker Ho Hogtied Home Made Hooker Hooters Hospital Hotel Hotpants Housewife Huge Cock Huge Dildo Huge Tits Huge Toy Humiliation Humping Hungarian Husband Hypnotized I Indian Indonesian Insertion Interracial Interview Intro Italian J Jacuzzi Jail Japanese Jeans Jerking Jewish Jizz Juggs Juicy Jungle K Kinky Kissing Kitchen Knockers Korean L Lace Lactating Lap Dancing Latex Latina Leather Legs Lesbian Lesbian Gangbang Lesbian Teen Lezdom Librarian Lick Lifeguard Limousine Lingerie Lipstick Lockerroom Lollipop Long Hair Long Legged Long Nails Lotion M Machine Fucking Machines Maid Maledom Mardi Gras Married Mask Massage Masturbating Mature Mature Amateur Mature Lesbian Mature Teacher Medical Mega Tits Melons Menstruation Messy Messy Facials Mexican Midget Milf Military Milk Miniskirt Mirror Missionary Mistress Mmf Moaning Monster Cock Monster Tits Mouthful Muff Diving Muscled N Natural Boobs Nature Nerdy Nipple Slip Nipples Noisy Nude Nudist Nudities Nun Nurse Nylon Nympho O Obese Office Oiled Old Farts Old Man Old Young Old Young Lesbian Oldy On Her Knees On Top Open Pussy Oral Orgasm Orgy Oriental Outdoor P Paddled Pain Pakistani Pale Panties Panty Sniffing Pantyhose Park Sex Party Penetrating Perky Perverted Petite Phone Piano Piercing Pigtail Pizza Playmate Plump Teen Plumper Poker Police Polish Ponyplay Ponytail Pool Poor Girl Pornstar Posing Pov Pretty Prolapse Prostate Prostitute Public Puffy Nipples Puking Pussy Pussy Stretching Pussy To Mouth Pussylips Pussypump R Ranch Raunchy Ravage Real Doll Reality Rectal Exam Red Bottom Redhead Retro Revenge Reverse Gangbang Rich Riding Rimjob Rocco Rubber Russian S Saggy Tits Sailor Sandwich Satin Sauna Screaming Secretary Security Cam Security Guard Seduce Sex Sex Tape Shaved Shaving Shemale Short Hair Shorts Shower Shy Silicon Tits Sissy Skank Skinny Skirt Slave Sleeping Slim Small Cock Small Tits Smoking Snatch Snowballing Soccer Socks Sofa Sex Solo Sologirl Sorority South California Spanish Spanked Speculum Sperm Spit Sports Spreading Spring Break Spy Squirt Stewardess Stockings Story Strap On Stripper Student Stupid Girl Submissive Sucking Sunbathing Surprise Swedish Swimsuit Swinger Swollen Pussy Sybian T Tall Tan Lines Tanned Tattoo Teacher Tease Teen Tennis Tgirl Thai Thong Throat Throat Fucked Tickling Tied Up Tight Tight Pussy Tiny Tiny Tits Titless Tits Titty Fuck Toes Topless Toys Trailer Girl Trampling Tranny Transformation Transsexual Transvestite Trib Tricked Trimmed Pussy Tugjob Turkish Twink Twins U Ugly Underwater Underwear Undressing Uniform University Unshaved Upskirt V Vaginal Cumshot Vampire Vegetable Vibrator Vintage VIP Room Vixen Voyeur W Waitress Waterbondage Watersport Webcam Wedding Wet Wet T-shirt Whaletail Whip White Whore Wife Wild Wine Wired Pussy Workout Worship Wrapped Bondage Wrestling Wtf X Xmas Y Yacht Young 1.Filthy Teen Movies 20 2.Free Hairy Xxx 20 3.New Porn Video 19 4.Hot Blowjob Porn 10 5.My Home Sex 6 6.HQ Free Porn 5 7.Love Video World 4 8.Fresh Porn Movies 4 9.Kind Teen Sex 2 10.Messy xxx tube 2 11.Matured Tube 2 12.Old Sex Tube 2 13.Amateur Xxx Tubes 1 14.Fresh Porn Tube 1 15.Jack Porn Tube 1 16.Private Porn Tube 1 17.Big Tits Love 1 1 19.4k Porn Movies 1 20.Wild Sex Tube 1 21.Private Sex Tube 0 22.Reality Porn Tube 0 23.Fresh Xxx Tube 0 24.Parental Porn Tube 0 25.Home Porn News 0 26.Origin Porn Tube 0 27.Hot Sex Tube 0 28.Xxx Tube Porn 0 29.Young Porn 0 30.New Fuck Tube 0 31.One Sex Tube 0 32.Free Sex Tube 0 33.XXX Tube 0 34.XXX Porn Sex Movies 0 35.Free Sex Movies XXX 0 36.Yak Movies 0 37.New Erotic Tube 0 38.Porn Tube 0 39.Glossy Tube 0 40.Tube Sex Trick 0 41.First Tranny Tube 0 42.Moms Tube 0 43.Free Sex Mummy 0 44.Your Porn Video 0 45.Mummy Sex Videos 0 46.Milf Tube 0 47.Mature Video Sex 0 48.Free Fetish Video 0 49.Fuck Video Porn 0 50.Asia xxx 0 Buy and Sell traffic Warning! This site contains sexually explicit, adult material and is for adults only! By entering this site, you certify that you are 18 years or older. 2007-2015 Report Abuse Whois

Whois Server Version 2.0
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to
for detailed information.
  Domain Name: ALFAVIDS.COM
  Registrar: ENOM, INC.
  Sponsoring Registrar IANA ID: 48
  Whois Server:
  Referral URL:
  Name Server: NS1.ALFAVIDS.COM
  Name Server: NS2.ALFAVIDS.COM
  Status: clientTransferProhibited
  Updated Date: 23-dec-2015
  Creation Date: 17-jan-2007
  Expiration Date: 17-jan-2017
>>> Last update of whois database: Fri, 20 May 2016 11:07:23 GMT <<<
For more information on Whois status codes, please visit
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and